Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF)
This Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
B5BIP0
Expression Region
1-156
Origin
Salmonella paratyphi A (strain AKU_12601)
Field of Research
Infectious Disease & Virology; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941731-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041129-100 1x 100 µL
MHC II (HLA-DP) (beta chain) (Bra-14), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2592-100 1x 100 µL
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), 0.2mg/mL
Sign In for Pricing
View Details 