Recombinant Escherichia fergusonii ATP synthase subunit b (atpF)
This Recombinant Escherichia fergusonii ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
B7LK81
Expression Region
1-156
Origin
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC801037-500 1x 500 µL
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details