Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit b (atpF)

This Recombinant Pseudomonas putida ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1JFU5

Expression Region

1-156

Origin

Pseudomonas putida (strain W619)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK AGQQLREAKAQAAEIIEQSKKRAAQLVEEARDQARVEADRVKAQALAEIEQELNSAKDAL RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK32B antibody
FNab08332 100 µg

STK32B antibody

Sign In for Pricing
View Details
GBA Rabbit mAb
E2R381727 100 µL

GBA Rabbit mAb

Sign In for Pricing
View Details
CENPB Rabbit Polyclonal Antibody
orb3069424-01 30 µL

CENPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CENPB Rabbit Polyclonal Antibody
orb3069424-02 50 µL

CENPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CENPB Rabbit Polyclonal Antibody
orb3069424-03 100 µL

CENPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CENPB Rabbit Polyclonal Antibody
orb3069424-04 200 µL

CENPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details