Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b' (atpG)

This Recombinant Synechococcus sp. ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q2JIF7

Expression Region

1-157

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFPTLLAVEAAEKGGLFDLDATLPLIAIQFLLLVAVLNSLFYEPVTRAIDSRNDYIRTT QAEAQERLDKAVSLTRQYESEISQARLQAQQVIAEAEAAAARIRSEKLAAVQAEIQQKLE AARLQVEQEKQAALEQLQQQVDAIAAQITQKLLGSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SHC1 Protein Lysate 20ug
IHUSHC1PLLY20UG 20 µg

Human SHC1 Protein Lysate 20ug

Sign In for Pricing
View Details
Ddx58 3'UTR Luciferase Stable Cell Line
TU104983 1.0 mL

Ddx58 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SPATA6L siRNA (Mouse)
MBS8213173-01 15 nmol

SPATA6L siRNA (Mouse)

Sign In for Pricing
View Details
SPATA6L siRNA (Mouse)
MBS8213173-02 30 nmol

SPATA6L siRNA (Mouse)

Sign In for Pricing
View Details
SPATA6L siRNA (Mouse)
MBS8213173-03 5x 30 nmol

SPATA6L siRNA (Mouse)

Sign In for Pricing
View Details
Anti-CAMKIV Rabbit Monoclonal Antibody
M01905-1 100 µL/Vial

Anti-CAMKIV Rabbit Monoclonal Antibody

Sign In for Pricing
View Details