Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1280 (MJ1280)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1280 (MJ1280) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1280

UniProt

Q58676

Expression Region

1-157

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILTLLIIFAIIGLLILIFGIWLIKKLLFPKKKPKPYQVRHGSSSSKRGYGSHDVYHH HYVTKDVYVHDYGDDDIYDERGKKEGDKDDSLIDKAIAFGAGAVTGYGVAEYGEEIKEEV EDIVKEGEDIIDDIVEEAEDFVEDVVDDFDNGGDDDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIS (4-AMINOPHENYL) METHANE
548-61-8 1 Each

TRIS (4-AMINOPHENYL) METHANE

Sign In for Pricing
View Details
Mouse Polyclonal HOXC8 Antibody
H00003224-B01P 50 µg

Mouse Polyclonal HOXC8 Antibody

Sign In for Pricing
View Details
G CSF (CSF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]
TA810833BM 100 µL

G CSF (CSF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details
TTTY18 ORF Vector (Human) (pORF)
ORF035283 1.0 µg DNA

TTTY18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Interleukin 31 (IL-31) (MaxLight 650)
I8442-40E-ML650 100 µL

Interleukin 31 (IL-31) (MaxLight 650)

Sign In for Pricing
View Details
Trim52 (NM_198601) Mouse Tagged Lenti ORF Clone
MR214306L3 10 µg

Trim52 (NM_198601) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details