Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)
This Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM14 (PAM18) spans the amino acid sequence from region 1-157.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit TIM14, Presequence translocated-associated motor subunit PAM18
UniProt
Q59SI2
Expression Region
1-157
Origin
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAPLEAPILAIPGENNTHQQQQQQFQYTGQLQKKKAAEGSIEWYFDQTINFMGDHPVITG IGAFAVAYFAAGFIKSNQPGINGKAFVKGGFGAKMTAKEALQILNLKETNLSKLKLKEQH RKLMMANHPDKGGSSYIATKINEAKDFLDKRGGMKPK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HV388145-01 1 Each
Anti-Human FOXP3 Monoclonal Antibody (1A211), FITC
Sign In for Pricing
View Details HV388145-02 100 Tests
Anti-Human FOXP3 Monoclonal Antibody (1A211), FITC
Sign In for Pricing
View Details 
MBS6288519-01 0.2 mL
CPT2, ID (CPT2, CPT1, Carnitine O-palmitoyltransferase 2, mitochondrial, Carnitine palmitoyltransferase II) (FITC)
Sign In for Pricing
View Details MBS6288519-02 5x 0.2 mL
CPT2, ID (CPT2, CPT1, Carnitine O-palmitoyltransferase 2, mitochondrial, Carnitine palmitoyltransferase II) (FITC)
Sign In for Pricing
View Details 