Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)
This Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-157.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
Q756G1
Expression Region
1-157
Origin
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSYLPTSSEADKDLDEMTFSEKMVFHCKREPLVPAGVLMTTGAILLAIKNVRSGNRRNAQ KWFRWRVGLQTGTLVALIAGSFFYGSAKHEQLSKEEQLRQKAKMREQLWIQELERRDLEV RRRKQRAEEARKKAAEMQSELSGLEQELRELEESRRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472290-500 1x 500 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details