What is the catalog number for Recombinant Human Protein GAPT (GAPT)?

The catalog number for Recombinant Human Protein GAPT (GAPT) is orb2931310.

What sizes are available for Recombinant Human Protein GAPT (GAPT)?

Recombinant Human Protein GAPT (GAPT) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Human Protein GAPT (GAPT) come in?

Recombinant Human Protein GAPT (GAPT) is available in 2 different pack sizes.

Is Recombinant Human Protein GAPT (GAPT) in stock?

Recombinant Human Protein GAPT (GAPT) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human Protein GAPT (GAPT)

This Recombinant Human Protein GAPT (GAPT) spans the amino acid sequence from region 1-157.

Product Specifications

Product Name Alternative

Protein GAPT, Growth factor receptor-bound protein 2-binding adapter protein, transmembrane

UniProt

Q8N292

Expression Region

1-157

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKT FLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNF EEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY