Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

This Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8) spans the amino acid sequence from region 29-186.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial, Complex I-ASHI, CI-ASHI, NADH-ubiquinone oxidoreductase ASHI subunit

UniProt

Q0MQE7

Expression Region

29-186

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPLSWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP7 (NM_178543) Human Tagged Lenti ORF Clone
RC208143L4 10 µg

ENPP7 (NM_178543) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MARCH3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9337R-BF350 100 µL

MARCH3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Anti-α-Actinin 4 (Tyr-4), Phosphospecific Antibody
AP4241 100 µL

Anti-α-Actinin 4 (Tyr-4), Phosphospecific Antibody

Sign In for Pricing
View Details
HTR2B discontinued
390220 200 µL

HTR2B discontinued

Sign In for Pricing
View Details
Fibronectin (FN1) Antibody
abx023900 0.2 mg

Fibronectin (FN1) Antibody

Sign In for Pricing
View Details
Rslcan-13 Double Nickase Plasmid (m)
sc-436579-NIC 20 µg

Rslcan-13 Double Nickase Plasmid (m)

Sign In for Pricing
View Details