Recombinant Synechococcus elongatus ATP synthase subunit b' (atpG)
This Recombinant Synechococcus elongatus ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-158.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
Q31RF4
Expression Region
1-158
Origin
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNAWMILAAEAVQEAEGGLFDLDATLPLMAVQILVLVFLLNAVFYKPFGKVLDDRDQFVR GGRQDAKARLAEVKALTAQYEQELAATRKQSQALIAEAQTEAGRIAAQQLAEAQREAQAQ REQAQQEIDQQKAVALQALDQQVDALSHQILDKLLARA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15196453 1 Vial
Lentiviral mouse D2hgdh shRNA (UAS) - Lentiviral mouse D2hgdh shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 