Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)
This Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM14 (PAM18) spans the amino acid sequence from region 1-158.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit TIM14, Presequence translocated-associated motor subunit PAM18
UniProt
Q759D2
Expression Region
1-158
Origin
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGI GGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVK DVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![N- (sec-Butyl) -N-[ (1-propyl-1,2,3,4-tetrahydroquinolin-6-yl) methyl]amine](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
sc-330484 500 mg
N- (sec-Butyl) -N-[ (1-propyl-1,2,3,4-tetrahydroquinolin-6-yl) methyl]amine
Sign In for Pricing
View Details bs-6157R-BF750 100 µL
RAB4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details 