Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit E (mrpE)
This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit E (mrpE) spans the amino acid sequence from region 1-158.
Product Specifications
Product Name Alternative
Na (+) /H (+) antiporter subunit E, Mrp complex subunit E, Multiple resistance and pH homeostasis protein E
UniProt
Q7WY60
Expression Region
1-158
Origin
Bacillus subtilis (strain 168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKL CFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMD ISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx00501-50gEcoli 50 µg (E. coli)
Recombinant Clostridium Perfringens galK Protein (aa 1-387) (strain SM101 / Type A)
Sign In for Pricing
View Details 
MBS1195430-01 0.02 mg (E-Coli)
Recombinant Thermosipho africanus Adenylosuccinate synthetase (purA)
Sign In for Pricing
View Details MBS1195430-02 0.02 mg (Yeast)
Recombinant Thermosipho africanus Adenylosuccinate synthetase (purA)
Sign In for Pricing
View Details MBS1195430-03 0.1 mg (E-Coli)
Recombinant Thermosipho africanus Adenylosuccinate synthetase (purA)
Sign In for Pricing
View Details