Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit E (mrpE)

This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit E (mrpE) spans the amino acid sequence from region 1-158.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E, Mrp complex subunit E, Multiple resistance and pH homeostasis protein E

UniProt

Q7WY60

Expression Region

1-158

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKL CFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMD ISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound STOCK1N-51130
T127100-01 10 mg

Compound STOCK1N-51130

Sign In for Pricing
View Details
Compound STOCK1N-51130
T127100-02 1 g

Compound STOCK1N-51130

Sign In for Pricing
View Details
Compound STOCK1N-51130
T127100-03 1 mg

Compound STOCK1N-51130

Sign In for Pricing
View Details
Compound STOCK1N-51130
T127100-04 50 mg

Compound STOCK1N-51130

Sign In for Pricing
View Details
Compound STOCK1N-51130
T127100-05 5 mg

Compound STOCK1N-51130

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 ENTS Polyclonal Antibody
MBS9005936 Inquire

Rabbit anti-Escherichia coli O157:H7 ENTS Polyclonal Antibody

Sign In for Pricing
View Details