Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (Ndufb8)

This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (Ndufb8) spans the amino acid sequence from region 29-186.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial, Complex I-ASHI, CI-ASHI, NADH-ubiquinone oxidoreductase ASHI subunit

UniProt

Q9D6J5

Expression Region

29-186

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDP WYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGH VFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VEGFC Antibody
MBS2401105-01 0.05 mg

Anti-VEGFC Antibody

Sign In for Pricing
View Details
Anti-VEGFC Antibody
MBS2401105-02 5x 0.05 mg

Anti-VEGFC Antibody

Sign In for Pricing
View Details
ZSA-51
orb2945112-01 10 mg

ZSA-51

Sign In for Pricing
View Details
ZSA-51
orb2945112-02 50 mg

ZSA-51

Sign In for Pricing
View Details
Canine Olfactory receptor 1N2 (OR1N2) ELISA Kit
GTR10326921 96 Well

Canine Olfactory receptor 1N2 (OR1N2) ELISA Kit

Sign In for Pricing
View Details
AMBN Antibody
orb1557884-01 50 μL

AMBN Antibody

Sign In for Pricing
View Details