Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU008 (UU008)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU008 (UU008) spans the amino acid sequence from region 1-158.

Product Specifications

Product Name Alternative

Uncharacterized protein UU008

UniProt

Q9PRD7

Expression Region

1-158

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFTSLLQDGIYEVGNGAIVTDQSPYLGITPDYQGAYGFPTHPWGIFFQVVGAILVFGAY LPAVIKVLISKRTENLAIGMWIISIAGLGLLAIFAWLGVSVNPGGFILVALSETLSCIAS IIVFALKIANKAKAKAAGMTELEYCNLHYPIVKKLPKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK15 Rabbit Polyclonal Antibody
TA374554 100 µL

CDK15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Benmijunzhi
TRC-B852360-50MG 50 mg

Benmijunzhi

Sign In for Pricing
View Details
Chmp4c Mouse Gene Knockout Kit (CRISPR)
KN503281 1 Kit

Chmp4c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human SELL Protein (His Tag)
PKSH033351-01 10 µg

Recombinant Human SELL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SELL Protein (His Tag)
PKSH033351-02 50 µg

Recombinant Human SELL Protein (His Tag)

Sign In for Pricing
View Details
Zfp51 Mouse Gene Knockout Kit (CRISPR)
KN519859 1 Kit

Zfp51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details