Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU008 (UU008)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU008 (UU008) spans the amino acid sequence from region 1-158.

Product Specifications

Product Name Alternative

Uncharacterized protein UU008

UniProt

Q9PRD7

Expression Region

1-158

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFTSLLQDGIYEVGNGAIVTDQSPYLGITPDYQGAYGFPTHPWGIFFQVVGAILVFGAY LPAVIKVLISKRTENLAIGMWIISIAGLGLLAIFAWLGVSVNPGGFILVALSETLSCIAS IIVFALKIANKAKAKAAGMTELEYCNLHYPIVKKLPKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF594 conjugate, 0.1mg/mL
BNC941423-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FUT8 Human Gene Knockout Kit (CRISPR)
KN212345RB 1 Kit

FUT8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tuberin (TSC2) Rabbit Polyclonal Antibody
AP06590PU-N 100 µg

Tuberin (TSC2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ms4a5 (NM_183190) Mouse Tagged ORF Clone
MG201954 10 µg

Ms4a5 (NM_183190) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Slc25a10 Mouse Gene Knockout Kit (CRISPR)
KN515955 1 Kit

Slc25a10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PEDF (SERPINF1) (NM_002615) Human Recombinant Protein
TP720443M 50 µg

PEDF (SERPINF1) (NM_002615) Human Recombinant Protein

Sign In for Pricing
View Details