Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

This Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8) spans the amino acid sequence from region 29-186.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial, Complex I-ASHI, CI-ASHI, NADH-ubiquinone oxidoreductase ASHI subunit

UniProt

O95169

Expression Region

29-186

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r22 Protein Vector (Mouse) (pPM-C-HA)
49763024 500 ng

Vmn2r22 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Zkscan4 (NM_001039115) Mouse Recombinant Protein
PM43463M5 20 µg

Zkscan4 (NM_001039115) Mouse Recombinant Protein

Sign In for Pricing
View Details
2'-Deoxycytidine HCl
ND02591-01 5 g

2'-Deoxycytidine HCl

Sign In for Pricing
View Details
2'-Deoxycytidine HCl
ND02591-02 10 g

2'-Deoxycytidine HCl

Sign In for Pricing
View Details
2'-Deoxycytidine HCl
ND02591-03 25 g

2'-Deoxycytidine HCl

Sign In for Pricing
View Details
2'-Deoxycytidine HCl
ND02591-04 50 g

2'-Deoxycytidine HCl

Sign In for Pricing
View Details