Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

This Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8) spans the amino acid sequence from region 29-186.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial, Complex I-ASHI, CI-ASHI, NADH-ubiquinone oxidoreductase ASHI subunit

UniProt

P0CB86

Expression Region

29-186

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPDLRLNWGEPMHWHLDMFNRNRVDTSPIPVSWNVMCMQLFGFLAFMIFMCWVGE VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKNK2 Antibody
MBS7118319-01 0.05 mg

MKNK2 Antibody

Sign In for Pricing
View Details
MKNK2 Antibody
MBS7118319-02 0.1 mg

MKNK2 Antibody

Sign In for Pricing
View Details
MKNK2 Antibody
MBS7118319-03 5x 0.1 mg

MKNK2 Antibody

Sign In for Pricing
View Details
BAI-1 Polyclonal Antibody
JOT-AP00827-01 20 µL

BAI-1 Polyclonal Antibody

Sign In for Pricing
View Details
BAI-1 Polyclonal Antibody
JOT-AP00827-02 50 μL

BAI-1 Polyclonal Antibody

Sign In for Pricing
View Details
BAI-1 Polyclonal Antibody
JOT-AP00827-03 100 µL

BAI-1 Polyclonal Antibody

Sign In for Pricing
View Details