Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Sigma-E factor regulatory protein RseC (rseC)

This Recombinant Escherichia coli Sigma-E factor regulatory protein RseC (rseC) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Sigma-E factor regulatory protein RseC

UniProt

P46187

Expression Region

1-159

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLV PGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDVAALCGAILGGIGGFLI ARGYSRKFAARAEWQPIILSVALPPGLVRFETSSEDASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPCR TGR7 (MRGPRD) (NM_198923) Human Over-expression Lysate
LY403698 100 µg

GPCR TGR7 (MRGPRD) (NM_198923) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rab9A Monoclonal Antibody
AN301646L-01 50 µL

Recombinant Rab9A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Rab9A Monoclonal Antibody
AN301646L-02 100 µL

Recombinant Rab9A Monoclonal Antibody

Sign In for Pricing
View Details
S100B (4C4.9), CF740 conjugate, 0.1mg/mL
BNC740143-500 1x 500 µL

S100B (4C4.9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS807056 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
CCKBR Human Gene Knockout Kit (CRISPR)
KN400676 1 Kit

CCKBR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details