Recombinant Treponema pallidum Uncharacterized protein TP_0707 (TP_0707)
This Recombinant Treponema pallidum Uncharacterized protein TP_0707 (TP_0707) spans the amino acid sequence from region 1-159.
Product Specifications
Product Name Alternative
Uncharacterized protein TP_0707
UniProt
O83705
Expression Region
1-159
Origin
Treponema pallidum (strain Nichols)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRGTPAYHAVSGVPCSACTCTQVAVQLALSWRGSMGRLKRCEVRRRPCALWAIVRVARIG ALAAMLAVLSFALGCALVYPLWALAVHRPRVFSVLSGLLYGGGAVLWGLRRVCNALSYAR VRRAGRRAAAQEPCVLVQAGEVGAMGLSSSAEVRPAQEC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680460-500 1x 500 µL
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880460-500 1x 500 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 