Recombinant Borrelia burgdorferi Uncharacterized protein BB_0268 (BB_0268)
This Recombinant Borrelia burgdorferi Uncharacterized protein BB_0268 (BB_0268) spans the amino acid sequence from region 1-159.
Product Specifications
Product Name Alternative
Uncharacterized protein BB_0268, ORF36
UniProt
Q44756
Expression Region
1-159
Origin
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFISRELKYILLTSVSALFISAVLGLFCGLSFFTILVRSLLQFVFFFVIGLLIEYIFKKY LSNLFSTELSGNMENKPQDDKKSDKDFKENLDFQNKNSLYENSQNISSSGDFIEEVKKYK FETEDVSRGSDKNKKMSFIEDNDPKVVADAIKTLMSKKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400270-100 1x 100 µL
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details