Recombinant Human Uncharacterized protein C12orf59 (C12orf59)
This Recombinant Human Uncharacterized protein C12orf59 (C12orf59) spans the amino acid sequence from region 25-183.
Product Specifications
Product Name Alternative
Uncharacterized protein C12orf59
UniProt
Q4KMG9
Expression Region
25-183
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
EENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGLTSLCFRCCCLSRQQNGEDGGPPPC EVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEEALHM SRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
24774124 3x 1.0µg DNA
IGSF1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details C2085-65M 50 µg
Casein Kinase 2 alpha, Control Peptide, Human (Casein Kinase II alpha Chain, Casein Kinase II alpha Subunit, Casein Kinase II Subunit alpha, CKII alpha, CKIIa, CKII, CK-II, CK2 alpha, CK2 Catalytic Subunit alpha, Casein Kinase 2 alpha 1 Polypeptide, Casein Kinase II alpha 1 Subunit, CK2A1, CSNK2A1) discontinued
Sign In for Pricing
View Details 139317 200 µL
APOC2 (Apolipoprotein C-II, Apo-CII, ApoC-II, APC2, Apolipoprotein C2)
Sign In for Pricing
View Details