Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Lipoprotein signal peptidase (lspA)

This Recombinant Synechococcus sp. Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II

UniProt

Q7U7A6

Expression Region

1-159

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSILRRAPLLGVAGLVVLVDQATKLLAASQLADGRIVQLLPGLINGQLVHNTGAAFSL FRGSVQWLGLLSLAVTTGLLIWVVRHRTPPFWQGMAVAFLLGGTLGNGIDRWRLGHVIDF LALVPINFPIFNPADIAINLAVLCFLVDLWSSRTSSRHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), Biotin conjugate, 0.1mg/mL
BNCB1045-100 1x 100 µL

CD16 (C16/1045), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF647 conjugate, 0.1mg/mL
BNC472295-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details