Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM87B (FAM87B)

This Recombinant Human Protein FAM87B (FAM87B) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Protein FAM87B

UniProt

Q8N852

Expression Region

1-159

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRQDLPRSRLGFLGLGGCGLIVKHGMTLRNWASFFVVFQAWSLMILQVLGDMLNIYYAY IQATLTLKVDVAPRLFFPEGGALKEHFSSMDSFQLREAGGTRIPRPALIYGRAVVTRTVT KAQSLRSALAWAALGCKHPVLSTLCEESQQGAWSEFRRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-500 1x 500 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF640R conjugate, 0.1mg/mL
BNC401761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF488A conjugate, 0.1mg/mL
BNC882153-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details