Recombinant Photosystem I reaction center subunit III (psaF)
This Recombinant Photosystem I reaction center subunit III (psaF) spans the amino acid sequence from region 29-187.
Product Specifications
Product Name Alternative
Photosystem I reaction center subunit III, PSI-F
UniProt
Q9TLW6
Expression Region
29-187
Origin
Cyanidium caldarium
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
STLTPCENSAQFQARLNNNIKKLENKLTYYKQNSQEYTSIKQQIEKTKIRFDKYAKSSLL CGEDGLPHLITDGDWQHSGEFFIPSVLFIYIAGWIGWAGKGYLQYSKTLTKPNENEIIID LPRALKYMFSGFAWPILALKEFKNGSLLASNDEITTSPR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470043-500 1x 500 µL
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040003-100 1x 100 µL
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
