Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ywmF (ywmF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ywmF (ywmF) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ywmF

UniProt

P70963

Expression Region

1-159

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGFNDMVKFLWSFLIVLPLVQIIHVSGHSFMAFIFGGKGSLDIGMGKTLLKIGPIRFRT IYFIDSFCRYGELKIDNRFSNALVYAGGCLFNLITIFAINLLIIHSVLKPNVFFYQFVYF STYYVFFALLPVRYSEKKSSDGLAIYKVLRYGERYEIDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish ABCE1 Antibody Picoband®
AZQ6TNW3-1 100 µg/Vial

Anti-Zebrafish ABCE1 Antibody Picoband®

Sign In for Pricing
View Details
Peroxiredoxin 4 (PRDX4) (NM_006406) Human Over-expression Lysate
E45H18513-2 20 µg

Peroxiredoxin 4 (PRDX4) (NM_006406) Human Over-expression Lysate

Sign In for Pricing
View Details
Streptococcus pneumoniae (Biotin)
S7974-71B-Biotin 100 µL

Streptococcus pneumoniae (Biotin)

Sign In for Pricing
View Details
Human TPSB2 knockdown cell line
ABC-KD15999 1 Vial

Human TPSB2 knockdown cell line

Sign In for Pricing
View Details
Porcine RNA binding protein PNO1 (PNO1) ELISA Kit
GTR10368758 96 Well

Porcine RNA binding protein PNO1 (PNO1) ELISA Kit

Sign In for Pricing
View Details
3- (Cyclopentanecarboxamido) benzoic acid
OR1005301 1 g

3- (Cyclopentanecarboxamido) benzoic acid

Sign In for Pricing
View Details