Recombinant Marchantia polymorpha Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Marchantia polymorpha Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
P06250
Expression Region
1-160
Origin
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGVTKKPDLSDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGAALPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1288625 Inquire
Recombinant Mycoplasma penetrans DNA ligase (ligA), partial
Sign In for Pricing
View Details 
MBS629892-01 0.2 mL
14-3-3 zeta, delta, CT (14-3-3 Protein zeta/delta, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAZ)
Sign In for Pricing
View Details