Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Marchantia polymorpha Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

P06250

Expression Region

1-160

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVTKKPDLSDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGAALPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oct-4B/OCT4B-190 Rabbit Polyclonal Antibody (APC)
orb994261 100 µL

Oct-4B/OCT4B-190 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Bovine Gamma Glutamyltransferase 1 ELISA Kit
OM623973 96 Strip Well

Bovine Gamma Glutamyltransferase 1 ELISA Kit

Sign In for Pricing
View Details
ZNF7 (Zinc Finger Protein 7, HF.16, KOX4, zf30, Zinc Finger Protein HF.16, Zinc Finger Protein KOX4) (Biotin)
135790-Biotin 100 µL

ZNF7 (Zinc Finger Protein 7, HF.16, KOX4, zf30, Zinc Finger Protein HF.16, Zinc Finger Protein KOX4) (Biotin)

Sign In for Pricing
View Details
Human Neuregulin 1 (NRG1), Active Protein
RPU58897-01 50 µg

Human Neuregulin 1 (NRG1), Active Protein

Sign In for Pricing
View Details
Human Neuregulin 1 (NRG1), Active Protein
RPU58897-02 100 µg

Human Neuregulin 1 (NRG1), Active Protein

Sign In for Pricing
View Details
Human Neuregulin 1 (NRG1), Active Protein
RPU58897-03 1 mg

Human Neuregulin 1 (NRG1), Active Protein

Sign In for Pricing
View Details