Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A2BPC7

Expression Region

1-160

Origin

Prochlorococcus marinus (strain AS9601)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENVNKF SNPFRRPIAMSVFLFGTFLTIYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(p-aminophenyl) Ether
TRC-B405510-50G 50 g

Bis(p-aminophenyl) Ether

Sign In for Pricing
View Details
Golgi Complex (371-4), CF740 conjugate, 0.1mg/mL
BNC740102-500 1x 500 µL

Golgi Complex (371-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 Human Gene Knockout Kit (CRISPR)
KN201916BN 1 Kit

TRIM29 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPK3 Antibody
8C11133-AAT 50 µg

MAPK3 Antibody

Sign In for Pricing
View Details
PFKFB3 (C-term) Rabbit Polyclonal Antibody
AP15137PU-N 400 µL

PFKFB3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Argininic Acid
TRC-A769195-50MG 50 mg

L-Argininic Acid

Sign In for Pricing
View Details