Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A2C0H2

Expression Region

1-160

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA FLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENINKF ANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP7 Rabbit mAb Antibody
orb1727336-01 50 µL

IGFBP7 Rabbit mAb Antibody

Sign In for Pricing
View Details
IGFBP7 Rabbit mAb Antibody
orb1727336-02 100 µL

IGFBP7 Rabbit mAb Antibody

Sign In for Pricing
View Details
ANKRD7 (Ankyrin Repeat Domain-Containing Protein 7, Ankyrin Repeat Domain 7)
475285 100 µL

ANKRD7 (Ankyrin Repeat Domain-Containing Protein 7, Ankyrin Repeat Domain 7)

Sign In for Pricing
View Details
CD27 Antibody, Biotin conjugated
A43266-50UG 50 µg

CD27 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-gD (HSV-1)
IT-005-004M5-01 0.1 mg

Anti-gD (HSV-1)

Sign In for Pricing
View Details
Anti-gD (HSV-1)
IT-005-004M5-02 0.5 mg

Anti-gD (HSV-1)

Sign In for Pricing
View Details