Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A2C0H2

Expression Region

1-160

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA FLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENINKF ANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticagrelor Impurity 6
CS-O-13899 1 Each

Ticagrelor Impurity 6

Sign In for Pricing
View Details
Rabbit Polyclonal Dynorphin Antibody
NBP2-97686-100ul 100 µL

Rabbit Polyclonal Dynorphin Antibody

Sign In for Pricing
View Details
APITD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
12149154 3x 1.0 µg DNA

APITD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Kinetochore protein Spc25 (SPC25) Mouse ELISA Kit
E5491 96 Tests

Kinetochore protein Spc25 (SPC25) Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant human RUNX3/CBFA3 protein
ATGP0576-250 250 µg

Recombinant human RUNX3/CBFA3 protein

Sign In for Pricing
View Details
PON1 Polyclonal Antibody
A71166-050 50 µL

PON1 Polyclonal Antibody

Sign In for Pricing
View Details