Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A3PB50

Expression Region

1-160

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENVNKF SNPFRRPIAMSVFLFGTFLTIYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO4 (NM_001029871) Human Over-expression Lysate
LY422255 100 µg

RSPO4 (NM_001029871) Human Over-expression Lysate

Sign In for Pricing
View Details
Cig2 (3A11/5), CF488A conjugate, 0.1mg/mL
BNC882827-100 1x 100 µL

Cig2 (3A11/5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EAAT1 (SLC1A3) (NM_001166695) Human Over-expression Lysate
LC433179 20 µg

EAAT1 (SLC1A3) (NM_001166695) Human Over-expression Lysate

Sign In for Pricing
View Details
P38 gamma/MAPK12 Recombinant Rabbit monoclonal Antibody
HA750892 100 µL

P38 gamma/MAPK12 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human UBFD1 activation kit by CRISPRa
GA111092 1 Kit

Human UBFD1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZBTB8B Human Gene Knockout Kit (CRISPR)
KN427516 1 Kit

ZBTB8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details