Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A5GR40

Expression Region

1-160

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHILKEPDLNDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVALAVLDPA MLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTMIPLGLMLVPFIESFNKF QNPFRRPVAMAVFLFGTAFTIYLGIGAALPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-S-(trichlorovinyl)-L-cysteine-d3
TRC-A189582-25MG 25 mg

N-Acetyl-S-(trichlorovinyl)-L-cysteine-d3

Sign In for Pricing
View Details
Recombinant TRIM21 Antibody
RC-007-01 50 μL

Recombinant TRIM21 Antibody

Sign In for Pricing
View Details
Recombinant TRIM21 Antibody
RC-007-02 100 µL

Recombinant TRIM21 Antibody

Sign In for Pricing
View Details
Recombinant TRIM21 Antibody
RC-007-03 1 mL

Recombinant TRIM21 Antibody

Sign In for Pricing
View Details
Sh3tc2 Mouse Gene Knockout Kit (CRISPR)
KN515731 1 Kit

Sh3tc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prohibitin (PHB) Rabbit Polyclonal Antibody
TA384971 100 µL

Prohibitin (PHB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details