Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhE2, Mrp complex subunit E2, Putative NADH-ubiquinone oxidoreductase subunit mnhE2

UniProt

A6QET7

Expression Region

1-160

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV2-CMV-Ecm1-2-3xFLAG-mCMV-ZsGreen1-Puro Plasmid
PVT78565 2 µg

PLV2-CMV-Ecm1-2-3xFLAG-mCMV-ZsGreen1-Puro Plasmid

Sign In for Pricing
View Details
GRID2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
22661151 3x 1.0 µg DNA

GRID2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rabbit Polyclonal AMIGO2 Antibody
NBP2-56648-25ul 25 µL

Rabbit Polyclonal AMIGO2 Antibody

Sign In for Pricing
View Details
Human Interferon Regulatory Factor 3 (IRF3) ELISA Kit
orb1947279-01 48 Tests

Human Interferon Regulatory Factor 3 (IRF3) ELISA Kit

Sign In for Pricing
View Details
Human Interferon Regulatory Factor 3 (IRF3) ELISA Kit
orb1947279-02 96 Tests

Human Interferon Regulatory Factor 3 (IRF3) ELISA Kit

Sign In for Pricing
View Details
Synaptotagmin-14 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11765R-BF647 100 µL

Synaptotagmin-14 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details