Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhE2, Mrp complex subunit E2, Putative NADH-ubiquinone oxidoreductase subunit mnhE2

UniProt

A8Z148

Expression Region

1-160

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCIAD2 Human shRNA Plasmid Kit (Locus ID 132299)
TR311040 1 Kit

OCIAD2 Human shRNA Plasmid Kit (Locus ID 132299)

Sign In for Pricing
View Details
Abaloparatide acetate
330223 5.0mg

Abaloparatide acetate

Sign In for Pricing
View Details
Rotatin (RTTN) Human siRNA Oligo Duplex (Locus ID 25914)
SR308593 1 Kit

Rotatin (RTTN) Human siRNA Oligo Duplex (Locus ID 25914)

Sign In for Pricing
View Details
CD79A (NM_021601) Human Tagged ORF Clone
RC215284 10 µg

CD79A (NM_021601) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Psychromonas ingrahamii Threonine--tRNA ligase (thrS), partial
MBS1220981 Inquire

Recombinant Psychromonas ingrahamii Threonine--tRNA ligase (thrS), partial

Sign In for Pricing
View Details
Recombinant Campylobacter Fetus xseA Protein (aa 1-387)
VAng-Lsx6174-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Fetus xseA Protein (aa 1-387)

Sign In for Pricing
View Details