Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A9BDY3

Expression Region

1-160

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLSDPKLRSKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLILIPFIENVNKF ANPFRRPVAMGFFLFGTLLTIYLGIGACFPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IkB-alpha Antibody (116) [DyLight 405]
NBP2-90043V 0.1 mL

Rabbit Monoclonal IkB-alpha Antibody (116) [DyLight 405]

Sign In for Pricing
View Details
CKAP4 Conjugated Antibody
C37490 100 µL

CKAP4 Conjugated Antibody

Sign In for Pricing
View Details
TNFRSF1A sgRNA CRISPR Lentivector set (Human)
K2414901 3x 1.0 µg

TNFRSF1A sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Adam39 (NM_001025380) Mouse Tagged ORF Clone Lentiviral Particle
MR214655L3V 200 µL

Adam39 (NM_001025380) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AGN 194310
T14143-01 5 mg

AGN 194310

Sign In for Pricing
View Details
AGN 194310
T14143-02 25 mg

AGN 194310

Sign In for Pricing
View Details