Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A9BDY3

Expression Region

1-160

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLSDPKLRSKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLILIPFIENVNKF ANPFRRPVAMGFFLFGTLLTIYLGIGACFPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DALDA acetate
T76439-01 5 mg

DALDA acetate

Sign In for Pricing
View Details
DALDA acetate
T76439-02 50 mg

DALDA acetate

Sign In for Pricing
View Details
4-Benzyl-3,3-difluoropiperidine hydrochloride
PC1004372 100 mg

4-Benzyl-3,3-difluoropiperidine hydrochloride

Sign In for Pricing
View Details
(αR) -4-Fluoro-α-hydroxy-benzenepropanoic Acid Methyl Ester
167228 10 mg

(αR) -4-Fluoro-α-hydroxy-benzenepropanoic Acid Methyl Ester

Sign In for Pricing
View Details
Goat anti Human IgG (H + L) (FITC)
MBS539842-01 2 mg

Goat anti Human IgG (H + L) (FITC)

Sign In for Pricing
View Details
Goat anti Human IgG (H + L) (FITC)
MBS539842-02 5x 2 mg

Goat anti Human IgG (H + L) (FITC)

Sign In for Pricing
View Details