Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Nostoc punctiforme Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

B2J5T0

Expression Region

1-160

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATQKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFAAIVALAVLDPA MTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMGSVPVGLILVPFIENVNKF QNPFRRPVATTVFLVGTLVTVWLGIGAALPLDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryge Mouse Gene Knockout Kit (CRISPR)
KN503872 1 Kit

Cryge Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF405S conjugate, 0.1mg/mL
BNC042240-500 1x 500 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Piperlongumine
TRC-P482850-25MG 25 mg

Piperlongumine

Sign In for Pricing
View Details
USP22 Rabbit Polyclonal Antibody
TA383151 100 µL

USP22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BioCoupler® x 24
BC24 24 Each

BioCoupler® x 24

Sign In for Pricing
View Details
Mouse Cenps activation kit by CRISPRa
GA208371 1 Kit

Mouse Cenps activation kit by CRISPRa

Sign In for Pricing
View Details