Recombinant Cyanothece sp. Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Cyanothece sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
B7K1G0
Expression Region
1-160
Origin
Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1) )
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSIQKKPDLSDPKLRAKLAQGMGHNYYGEPAWPNDLLYVFPVVILGTIGLVTALAVLDPA LVGEPADPFATPLEILPEWYLYPVFQILRILPNKLLGIACQAAIPLGLMLVPFIESVNKF QNPFRRPVATAVFLFGTVVTLWLGAGATFPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880158-500 1x 500 µL
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470270-500 1x 500 µL
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040158-500 1x 500 µL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741878-500 1x 500 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details