Recombinant Guillardia theta Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Guillardia theta Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
O78415
Expression Region
1-160
Origin
Guillardia theta (Cryptomonas phi)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSVLKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTLACVIGLSVLAPS PIGEKADPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPVGLITVPFIESVNKF QNPFRRPVAMTVFVFSVVFAIWLGIGATMPINKALTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742289-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941680-100 1x 100 µL
CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682474-100 1x 100 µL
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details