Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Microcystis aeruginosa Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Microcystis aeruginosa Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

B0JM93

Expression Region

1-160

Origin

Microcystis aeruginosa (strain NIES-843)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLKKPDLSDPALRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIFGTIGLCTGLAIMDPT MIGEPADPFATPLEILPEWYLYPVFQILRILPNKLLGIACMAGVPLGLMLVPFIESVNKF QNPFRRPVATAIFLFGTVVTIWLGIGATFPIDISLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
EGFR (GFR1195 + 31G7), CF594 conjugate, 0.1mg/mL
BNC941200-100 1x 100 µL

EGFR (GFR1195 + 31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details