Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q0ICP7

Expression Region

1-160

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACIVGLSVLDPA MLGDKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLIPFIESFNKF QNPFRRPIAMAVFLFGTATTIYLGIGAAMPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2’,3’-cGAMP-iFluor® 488 conjugate
20320-AAT 100 µg

2’,3’-cGAMP-iFluor® 488 conjugate

Sign In for Pricing
View Details
4-(Acetylamino)-2-aminobenzenesulfonic Acid
TRC-A164320-50G 50 g

4-(Acetylamino)-2-aminobenzenesulfonic Acid

Sign In for Pricing
View Details
PPRC1 Antibody
8C17657-AAT 50 µg

PPRC1 Antibody

Sign In for Pricing
View Details
SHC (SHC1) pTyr427 Rabbit Polyclonal Antibody
AP02542PU-N 100 µL

SHC (SHC1) pTyr427 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human FcRn & B2M Heterodimer (C-6His-Avi) Biotinylated
PKSH033906-01 20 µg

Recombinant Human FcRn & B2M Heterodimer (C-6His-Avi) Biotinylated

Sign In for Pricing
View Details
Recombinant Human FcRn & B2M Heterodimer (C-6His-Avi) Biotinylated
PKSH033906-02 100 µg

Recombinant Human FcRn & B2M Heterodimer (C-6His-Avi) Biotinylated

Sign In for Pricing
View Details