Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q1XDE7

Expression Region

1-160

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIIGTFACSIGLAILEPS SIGEKSNPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPAGLLTVPFIENVNKF QNPFRRPIATTVFLIGTVVSIWLGIGATMPINNAITLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR2 Antibody
MBS9404466-01 0.05 mL

ACTR2 Antibody

Sign In for Pricing
View Details
ACTR2 Antibody
MBS9404466-02 0.1 mL

ACTR2 Antibody

Sign In for Pricing
View Details
ACTR2 Antibody
MBS9404466-03 5x 0.1 mL

ACTR2 Antibody

Sign In for Pricing
View Details
CL-0619-969 AF Systems Consumables
032665 Roll of 500 Label(s)

CL-0619-969 AF Systems Consumables

Sign In for Pricing
View Details
RPL29P2 Protein Vector (Human) (pPM-C-HA)
PV121964 500 ng

RPL29P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Human SPOUT1 Polyclonal Antibody
HD297014-01 50 µg

Anti-Human SPOUT1 Polyclonal Antibody

Sign In for Pricing
View Details