Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q3AMC2

Expression Region

1-160

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHILKKPDLSDPKMRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLVPFIESFNKF QNPFRRPVAMTVFLTGTLVTIYLGIGAALPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS710061 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Cytokeratin 17 (E3), 0.2mg/mL
BNUB0158-100 1x 100 µL

Cytokeratin 17 (E3), 0.2mg/mL

Sign In for Pricing
View Details
Polystyrene A FP
HA110007.25G 25 g

Polystyrene A FP

Sign In for Pricing
View Details
STUB1 Antibody
KC-3138-01 50 μL

STUB1 Antibody

Sign In for Pricing
View Details
STUB1 Antibody
KC-3138-02 100 µL

STUB1 Antibody

Sign In for Pricing
View Details
STUB1 Antibody
KC-3138-03 1 mL

STUB1 Antibody

Sign In for Pricing
View Details