Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q3AMC2
Expression Region
1-160
Origin
Synechococcus sp. (strain CC9605)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHILKKPDLSDPKMRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLADKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLVPFIESFNKF QNPFRRPVAMTVFLTGTLVTIYLGIGAALPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BT10 96 Tips/Rack - 10 Racks/PK
Neptune Filter Tips 0.1-10 µL Universal Fit Racked, Low Retention, Pre-Sterilized
Sign In for Pricing
View Details ![NAPSIN A (NAPSA) (N-term) Mouse Monoclonal Antibody [Clone ID: KCG1.1]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbb91/imageurl/am03172pu-n.webp)
AM03172PU-N 1 mL
NAPSIN A (NAPSA) (N-term) Mouse Monoclonal Antibody [Clone ID: KCG1.1]
Sign In for Pricing
View Details 
TRC-S561235-25MG 25 mg
(2R)-1-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-3-(stearoyloxy)propan-2-yl (4Z,7Z,10Z,13Z,16Z,19Z)-docosa-4,7,10,13,16,19-hexaenoate
Sign In for Pricing
View Details 