Recombinant Synechococcus sp. ATP synthase subunit b (atpF)
This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q3AZM3
Expression Region
1-160
Origin
Synechococcus sp. (strain CC9902)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLNFNPLETNLVNLAIVIGVLFWFLRGFLGGILERRRSAILQDLQDAEARLKTASEELT KAQSELAAAQQKAEQIRIDGQKRAAAIRAEGEKRTISVMAAIKQGAAADADAEASRIKDA LRREAAMAAIDKVLTDLPGRLDDAAQSRLIDSTIRNLENA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BRCA1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]](https://cdn.genprice.uk/products/937/68dd1b78061270361ea1b26a/imageurl/ta802672bm.webp)
TA802672BM 100 µL
BRCA1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C4]
Sign In for Pricing
View Details 
BNC042729-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880900-100 1x 100 µL
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 