Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q3AZM3

Expression Region

1-160

Origin

Synechococcus sp. (strain CC9902)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNFNPLETNLVNLAIVIGVLFWFLRGFLGGILERRRSAILQDLQDAEARLKTASEELT KAQSELAAAQQKAEQIRIDGQKRAAAIRAEGEKRTISVMAAIKQGAAADADAEASRIKDA LRREAAMAAIDKVLTDLPGRLDDAAQSRLIDSTIRNLENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Rel Polyclonal Antibody
E-AB-11102-01 20 µL

C-Rel Polyclonal Antibody

Sign In for Pricing
View Details
C-Rel Polyclonal Antibody
E-AB-11102-02 60 µL

C-Rel Polyclonal Antibody

Sign In for Pricing
View Details
C-Rel Polyclonal Antibody
E-AB-11102-03 120 µL

C-Rel Polyclonal Antibody

Sign In for Pricing
View Details
C-Rel Polyclonal Antibody
E-AB-11102-04 200 µL

C-Rel Polyclonal Antibody

Sign In for Pricing
View Details
Slc12a2 Mouse Gene Knockout Kit (CRISPR)
KN515862 1 Kit

Slc12a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF405S conjugate, 0.1mg/mL
BNC042552-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details