Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q3AZM3

Expression Region

1-160

Origin

Synechococcus sp. (strain CC9902)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNFNPLETNLVNLAIVIGVLFWFLRGFLGGILERRRSAILQDLQDAEARLKTASEELT KAQSELAAAQQKAEQIRIDGQKRAAAIRAEGEKRTISVMAAIKQGAAADADAEASRIKDA LRREAAMAAIDKVLTDLPGRLDDAAQSRLIDSTIRNLENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APRIL Antibody
KC-22085-01 50 μL

APRIL Antibody

Sign In for Pricing
View Details
APRIL Antibody
KC-22085-02 100 µL

APRIL Antibody

Sign In for Pricing
View Details
APRIL Antibody
KC-22085-03 1 mL

APRIL Antibody

Sign In for Pricing
View Details
M-MuLV Reverse Transcriptase (RNase H-), 50000U
ME2306 50000 U

M-MuLV Reverse Transcriptase (RNase H-), 50000U

Sign In for Pricing
View Details
COX17 Mouse Monoclonal Antibody [Clone ID: OTI3H4]
CF812201 100 µg

COX17 Mouse Monoclonal Antibody [Clone ID: OTI3H4]

Sign In for Pricing
View Details
Rabbit IgG (Fab Fragment specific), AlpSdAbs® VHH
HA710050 100 µg

Rabbit IgG (Fab Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details