Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q3AHK3

Expression Region

1-160

Origin

Synechococcus sp. (strain CC9605)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLNLNPLETNLVNLVIVIGLLFWFLRGFLGGILERRRAAILQELQDAESRLKTATENLS QAQSELAAAQQKAEKIRADGQARAAGIRAEGEKRTISVMAAIKAGADADAEADAARIKDS LRREAALAAIDKALAVLPARLDASAQAKLIDSTIKNLENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human C5a mAb
E409C10-h100-50 50 µg

Human anti-human C5a mAb

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung: right upper lobe
CB540559 1 Block

Frozen Tissue Blocks, Lung: right upper lobe

Sign In for Pricing
View Details
Monoclonal MCL-1 Antibody, Clone: 8C6; 8C6D4B1
APR08381G 0.1ml

Monoclonal MCL-1 Antibody, Clone: 8C6; 8C6D4B1

Sign In for Pricing
View Details
HSPA9 Rabbit Polyclonal Antibody
E10G01426 100 µL

HSPA9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ErbB-3 Recombinant Monoclonal Antibody
RAA00384-01 100 µL

ErbB-3 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
ErbB-3 Recombinant Monoclonal Antibody
RAA00384-02 200 µL

ErbB-3 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details