Recombinant Acorus calamus Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Acorus calamus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q3V503
Expression Region
1-160
Origin
Acorus calamus (Sweet flag)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAILEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMASVPLGLFTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400803-500 1x 500 µL
Cytokeratin 8 (KRT8/803), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details